PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C022282P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 167aa    MW: 19323.3 Da    PI: 10.7346
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C022282P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding409e-131459146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W  eEde l++ v+++G+++W++I ++  + Rt+k+c++rw +
   MELO3C022282P1 14 KGPWKLEEDEVLLNHVNRFGPRDWSSIRSKGLLQRTGKSCRLRWVN 59
                     79*************************8887799**********87 PP

2Myb_DNA-binding48.81.6e-1570109344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      ++T+eE++  +++ +q+G++ W++Ia +++ gRt++++k++w
   MELO3C022282P1  70 KFTAEEEKMVIELQAQFGNK-WAKIATYLP-GRTDNDVKNFW 109
                      79******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.463961IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-201062IPR009057Homeodomain-like
SMARTSM007174.5E-91363IPR001005SANT/Myb domain
SuperFamilySSF466891.73E-2813109IPR009057Homeodomain-like
PfamPF002496.7E-111459IPR001005SANT/Myb domain
CDDcd001675.64E-91661No hitNo description
PROSITE profilePS5129420.08862117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-1963115IPR009057Homeodomain-like
SMARTSM007171.2E-1367115IPR001005SANT/Myb domain
PfamPF002495.9E-1470109IPR001005SANT/Myb domain
CDDcd001677.49E-1170109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MEDRRSQSHE VLRKGPWKLE EDEVLLNHVN RFGPRDWSSI RSKGLLQRTG KSCRLRWVNK  60
LRPNLKNGCK FTAEEEKMVI ELQAQFGNKW AKIATYLPGR TDNDVKNFWS SRQKRLARLL  120
QTSPAPSKLQ RSAKKETPVD FDIPTMEVFS LLISSDILDL RFLAVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-291211525126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819251e-167LN681925.1 Cucumis melo genomic scaffold, anchoredscaffold00052.
GenBankLN7132651e-167LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008459792.11e-105PREDICTED: myb-related protein 308-like
SwissprotA2WW871e-37GAM1_ORYSI; Transcription factor GAMYB
SwissprotQ0JIC21e-37GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLA0A061DVG43e-77A0A061DVG4_THECC; Myb-like HTH transcriptional regulator family protein, putative
STRINGVIT_15s0021g02040.t012e-73(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36933164
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.13e-71MYB family protein